<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21248
| Description |
Uncharacterized protein |
| Sequence | MKLYQDDWLKTSASSLQLWEKAPLEPYALQKPITYYVVCPDIDPLTSAAADFFQQLGTVYETCKLGTHLPQSFGSQMEVDSGRRPSSGFVLLDCPQAMKIESRNASLVGSLSDYFLSISNGWDLTSYLKSLSKALKALKLGHCLSTNAKEGSSGPSTVIYVVCPFPEPIAILQTVIESSIAIGSVIFQSDRERRSTLYSQVSKALSYSATVDEASISNILVLSGFSIPKLVLQIVTVDAIFKVTSPSLNELVILKETAFTVYNKARRISRGASSDAIQSSLSSRSHSVLSQMSSPTPGTWKDWGPSNYWAFPSKRG |
| Length | 316 |
| Position | Kinase |
| Organism | Prunus yedoensis var. nudiflora |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.032 |
| Instability index | 52.84 |
| Isoelectric point | 8.48 |
| Molecular weight | 34506.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21248
No repeats found
|