<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21240
Description |
Mediator of RNA polymerase II transcription subunit 12 isoform X2 |
Sequence | MEKRTITVWLMTVIRQLVEETEKTIAKVGQFGRTFTSVDDRSSIRWKLGEDELSAALYLMDISNDLVLAVKFLLWLLPKVSSPSSTFHSGRNILLLPKNVESQVCEVGEAFLISSLRRYENVVIATDLIPEVLSAIMHRASAVVASNGRLSGSPALAYSRYLSKRYVMWLVSLNGRRISRQHVIRDFFLNSSLDNQWMESWGFHLVFQQGLKILMIFSAKRLVVSGCPGRV |
Length | 231 |
Position | Kinase |
Organism | Prunus yedoensis var. nudiflora |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | 0.146 |
Instability index | 49.38 |
Isoelectric point | 9.73 |
Molecular weight | 26180.24 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21240
No repeats found
|