<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21240
| Description |
Mediator of RNA polymerase II transcription subunit 12 isoform X2 |
| Sequence | MEKRTITVWLMTVIRQLVEETEKTIAKVGQFGRTFTSVDDRSSIRWKLGEDELSAALYLMDISNDLVLAVKFLLWLLPKVSSPSSTFHSGRNILLLPKNVESQVCEVGEAFLISSLRRYENVVIATDLIPEVLSAIMHRASAVVASNGRLSGSPALAYSRYLSKRYVMWLVSLNGRRISRQHVIRDFFLNSSLDNQWMESWGFHLVFQQGLKILMIFSAKRLVVSGCPGRV |
| Length | 231 |
| Position | Kinase |
| Organism | Prunus yedoensis var. nudiflora |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.146 |
| Instability index | 49.38 |
| Isoelectric point | 9.73 |
| Molecular weight | 26180.24 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21240
No repeats found
|