<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21231

Description Mediator of RNA polymerase II transcription subunit 8 isoform X1
SequenceMAAMEGVVQNQPPQPQQQQPPQPMAVERLNDAVQQQLNLESVKTRAISLFKAISRILDDLNAYAYANTTPKWQDILSQYSMVNLELFNIVDEIKKVSKAFVVHPKNVNAENSTVLPVMLSSKLLPEMEVEDNAKREQLLHGLQSLPIGSQIEKLKARIDMIGAACESAEKVLADTRKAYCFGTRQGIPIVPTLDKAQAAKIQEQENLLRAAVNFGEGLRLPVDQRQNTTALPMHLVDVLTVGDGAQPFAETSGMYLKNTPVSSSNLTAQSPLMQVSGSQLMGRPAASPGGTSVSNFDNTTTSPLPYANSPRQSAMQGLGQNQLQQLHDLQQGQAQKFQSLHGQHQMQFSQPLGHQQFQGRQLPSGHVQHGIGQNQLNPGNQMNRHLGQFSGTANSALFNAAQTTPSQMIPNISATMPSQSLLPRMQFELSGNNPQRSHASQMLSDQMFNMGAANTGGMMPLQQQQQQQQQQHGSQGGFGNIPQNAQNIQSNMVALQGTPQNHPNFGQQRQQNQQ
Length514
PositionHead
OrganismPrunus yedoensis var. nudiflora
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.04
Grand average of hydropathy-0.575
Instability index54.16
Isoelectric point7.86
Molecular weight56236.70
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21231
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     233.26|      40|      40|     378|     417|       1
---------------------------------------------------------------------------
  244-  276 (28.05/ 7.28)	.GAQ..................PFAETSGMYLKNTPvsssnLTAQS..........PLM.....Q.....VS
  277-  310 (51.07/18.65)	GSQLMG............RPAASPGGTSVSN.FDNT.....TTSP.............LPY..AN.....SP
  325-  377 (31.22/ 8.84)	QLHDLQqgqaqkfqslhgQHQMQFSQPLGHQQFQGR.....QL.PSghvqhgigqnQ.............LN
  378-  417 (70.43/28.21)	PGNQMN............RHLGQFSGTANSALFNAA.....QTTPS..........QMIPNISAT.....MP
  418-  460 (52.48/19.34)	SQSLLP............RMQFELSGN.NPQRSHAS.....QMLSD..........QMF.NMGAAntggmMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.48|      14|      42|     143|     156|       3
---------------------------------------------------------------------------
  143-  156 (23.16/13.38)	QSLPIGSQIEKLKA
  185-  198 (24.32/14.38)	QGIPIVPTLDKAQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.28|      16|      20|     475|     491|       5
---------------------------------------------------------------------------
  475-  490 (28.36/ 6.60)	QGGFGNIPQNAQNIQS
  496-  511 (31.92/ 9.12)	QGTPQNHPNFGQQRQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21231 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LTAQSPLMQVSGSQLMGRPAASPGGTSVSNFDNTTTSPLPYANSPRQSAMQGLGQNQLQQLHDLQQGQAQKFQSLHGQHQMQFSQPLGHQQFQGRQLPSGHVQHGIGQNQLNPGNQMNRHLGQFSGTANSALFNAAQTTPSQMIPNISATMPSQSLLPRMQFELSGNNPQRSHASQMLSDQMFNMGAANTGGMMPLQQQQQQQQQQHGSQGGFGNIPQNAQNIQSNMVALQGTPQNHPNFGQQRQQNQQ
266
514










Molecular Recognition Features






MoRF SequenceStartStop




NANANA