Description | Mediator of RNA polymerase II transcription subunit 16 isoform X2 |
Sequence | MGSRRDVVTAVWKTGLEGVWYKCIRCLRQTSAFASPGATSRPNQTGRETWWISRWAYCCPMCGGTWIGHTEAFVKAIILEDDPGFRVAGCKSSSPDLDLSIHL |
Length | 103 |
Position | Tail |
Organism | Prunus yedoensis var. nudiflora |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.157 |
Instability index | 44.56 |
Isoelectric point | 8.63 |
Molecular weight | 11453.02 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21217 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) PDLDLS 2) RETWWISRWAY | 95 47 | 100 57 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab