| Description | Mediator of RNA polymerase II transcription subunit 16 isoform X2 |
| Sequence | MGSRRDVVTAVWKTGLEGVWYKCIRCLRQTSAFASPGATSRPNQTGRETWWISRWAYCCPMCGGTWIGHTEAFVKAIILEDDPGFRVAGCKSSSPDLDLSIHL |
| Length | 103 |
| Position | Tail |
| Organism | Prunus yedoensis var. nudiflora |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus. |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.157 |
| Instability index | 44.56 |
| Isoelectric point | 8.63 |
| Molecular weight | 11453.02 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP21217 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) PDLDLS 2) RETWWISRWAY | 95 47 | 100 57 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab