Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGTESDETADTPPLTNTIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPDYTKFIMYPHCLFFLEQLQNANFRNAMAHPANKELAHRQQFYFWKNYRNNRLKHILPRPLPEPVAAPPTPAPPQQPVPPVAATTVSVTANAPAPSPMQYAVPPGSALAKNEARNSGVDRRKRKKEG |
Length | 200 |
Position | Middle |
Organism | Prunus yedoensis var. nudiflora |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.706 |
Instability index | 56.28 |
Isoelectric point | 9.00 |
Molecular weight | 22951.74 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21214 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.31| 15| 27| 142| 156| 2 --------------------------------------------------------------------------- 142- 156 (31.80/13.37) PTPAPPQQPVPPVAA 166- 180 (31.51/13.19) PAPSPMQYAVPPGSA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.81| 20| 27| 31| 50| 3 --------------------------------------------------------------------------- 31- 50 (35.99/22.70) FLLELEFVQCLANPTYIHYL 61- 80 (38.81/24.96) FIGYLKYLQYWQRPDYTKFI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GVDRRKRKKE 2) LAKNEAR 3) PMQYAVPPG 4) WKNYRNNRL | 190 181 170 118 | 199 187 178 126 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab