<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21214
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASGTESDETADTPPLTNTIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPDYTKFIMYPHCLFFLEQLQNANFRNAMAHPANKELAHRQQFYFWKNYRNNRLKHILPRPLPEPVAAPPTPAPPQQPVPPVAATTVSVTANAPAPSPMQYAVPPGSALAKNEARNSGVDRRKRKKEG |
| Length | 200 |
| Position | Middle |
| Organism | Prunus yedoensis var. nudiflora |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.706 |
| Instability index | 56.28 |
| Isoelectric point | 9.00 |
| Molecular weight | 22951.74 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21214
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.31| 15| 27| 142| 156| 2
---------------------------------------------------------------------------
142- 156 (31.80/13.37) PTPAPPQQPVPPVAA
166- 180 (31.51/13.19) PAPSPMQYAVPPGSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.81| 20| 27| 31| 50| 3
---------------------------------------------------------------------------
31- 50 (35.99/22.70) FLLELEFVQCLANPTYIHYL
61- 80 (38.81/24.96) FIGYLKYLQYWQRPDYTKFI
---------------------------------------------------------------------------
|