<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21204
| Description |
Putative mediator of rna polymerase ii transcription subunit 19b |
| Sequence | MDSDSKNFGRGPRELTGARDLISHFKLLPHYEFFCKRSLPLSISDTRYLHNVVGDREIRKGEGMQLDQLTQDTSFSKETKSCIRPFDLDVLREAFLLRETAPVDLSPSEKGIPTIAGKSKSEMKDKEKKHKKHKDKDKEKDKEHNKHKHRHKDRSKEKKKDKSGHHDPGAEHSKKHEKKRKHDDEDLNGVHKHKKSKVNSKILSYIIFFTILQPCLLKKKYICKL |
| Length | 225 |
| Position | Head |
| Organism | Nicotiana attenuata (Coyote tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.223 |
| Instability index | 36.11 |
| Isoelectric point | 9.67 |
| Molecular weight | 26282.88 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21204
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.87| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (29.23/12.05) DKEKKH.......KKHKDKDKE
161- 182 (20.64/ 6.42) DKSGHHdpgaehsKKHEKKRKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.70| 19| 40| 141| 160| 2
---------------------------------------------------------------------------
141- 160 (30.38/16.82) DKEHNKHKHRHKdRSKEKKK
183- 201 (33.32/14.61) DDEDLNGVHKHK.KSKVNSK
---------------------------------------------------------------------------
|