<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21195
| Description |
Mediator of rna polymerase ii transcription subunit 19a |
| Sequence | MDPDCKSFGRGARELTGAVDLISHFKLLPHHEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQDTSLSRETSSRIQPFDLDVLGEAFQLREAAPVVLPPSEKGIPTVAGKSISESKDKDKKRKKHKDKDKEKDKEHKKNKHRHKDRSKDKDKEKKRDKNGHHDSGADHSKKHREKKRKHDGEDLNDVHKHKRSKHKSSKIDEIGAVKVAA |
| Length | 218 |
| Position | Head |
| Organism | Nicotiana attenuata (Coyote tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.327 |
| Instability index | 39.70 |
| Isoelectric point | 9.56 |
| Molecular weight | 24914.84 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21195
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.53| 18| 21| 133| 153| 1
---------------------------------------------------------------------------
133- 150 (35.41/14.86) HKDKDKEKDKEHKKNKHR
187- 204 (29.13/ 6.03) HDGEDLNDVHKHKRSKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.25| 15| 31| 118| 132| 2
---------------------------------------------------------------------------
118- 132 (25.20/11.73) KSISESKDKDKKRKK
152- 166 (26.05/12.39) KDRSKDKDKEKKRDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.72| 12| 15| 49| 60| 3
---------------------------------------------------------------------------
49- 60 (19.79/14.82) LHNVVGDTEIRK
66- 77 (18.93/13.91) LDQLIQDTSLSR
---------------------------------------------------------------------------
|