<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21189
Description |
Mediator of rna polymerase ii transcription subunit 30 |
Sequence | MEEKGGTLTNSKTIQELAVEGQKHLEDTIEAAHPILSAMNDELCNPTLWSTTPNMAATTSANAVMSNGQQQQHSNGAGDVSSDNSSSSLASAQHHLDIGGGALDESRLRYKSSIACLRSVLTAISNAQKAKALEAASASGSLSAADQAEIEQLEEHASTLKKELVDKNKHLKLLIDQLRDLLSDLSIWQSPCST |
Length | 194 |
Position | Head |
Organism | Nicotiana attenuata (Coyote tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.414 |
Instability index | 43.30 |
Isoelectric point | 5.06 |
Molecular weight | 20593.60 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21189
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.14| 22| 144| 15| 37| 1
---------------------------------------------------------------------------
15- 37 (33.28/29.44) QELaVEGQKHLEDTIEAAHPILS
162- 183 (35.86/26.39) KEL.VDKNKHLKLLIDQLRDLLS
---------------------------------------------------------------------------
|