Description | Mediator of rna polymerase ii transcription subunit 30 |
Sequence | MEEKGGIMTNPKTIQELAVEGQRHLEDTIEAAHQILSAMNDELCNPTLWSTTPNTAATTSANAVMSNGQQQHHSNGGGDVLSDNSSSSSASAQQHLDIGGGALDGSRLRYKSSIACLRSVLTAISNAQKAKALEAASASCSLSAADQAEIEQLEERASTLKKELVDKNKHLKLLIDQLRDLLSDLSTWQSPCST |
Length | 194 |
Position | Head |
Organism | Nicotiana attenuata (Coyote tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.441 |
Instability index | 45.08 |
Isoelectric point | 5.18 |
Molecular weight | 20629.66 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP21188 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.17| 19| 22| 70| 90| 1 --------------------------------------------------------------------------- 70- 90 (28.70/22.85) QQHHSNGGGDvLsDNS....SSSSA 93- 115 (30.46/15.69) QQHLDIGGGA.L.DGSrlryKSSIA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.95| 11| 22| 150| 160| 2 --------------------------------------------------------------------------- 150- 160 (17.74/12.29) IEQLEERASTL 175- 185 (18.21/12.80) IDQLRDLLSDL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SAQQHLDIG 2) SRLRYKS | 91 106 | 99 112 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab