<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21188
| Description |
Mediator of rna polymerase ii transcription subunit 30 |
| Sequence | MEEKGGIMTNPKTIQELAVEGQRHLEDTIEAAHQILSAMNDELCNPTLWSTTPNTAATTSANAVMSNGQQQHHSNGGGDVLSDNSSSSSASAQQHLDIGGGALDGSRLRYKSSIACLRSVLTAISNAQKAKALEAASASCSLSAADQAEIEQLEERASTLKKELVDKNKHLKLLIDQLRDLLSDLSTWQSPCST |
| Length | 194 |
| Position | Head |
| Organism | Nicotiana attenuata (Coyote tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.441 |
| Instability index | 45.08 |
| Isoelectric point | 5.18 |
| Molecular weight | 20629.66 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21188
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.17| 19| 22| 70| 90| 1
---------------------------------------------------------------------------
70- 90 (28.70/22.85) QQHHSNGGGDvLsDNS....SSSSA
93- 115 (30.46/15.69) QQHLDIGGGA.L.DGSrlryKSSIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.95| 11| 22| 150| 160| 2
---------------------------------------------------------------------------
150- 160 (17.74/12.29) IEQLEERASTL
175- 185 (18.21/12.80) IDQLRDLLSDL
---------------------------------------------------------------------------
|