<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21183

Description Heat shock 70 kDa protein
SequenceMATKEGKAIGIDLGTTYSCVGVWLNDRVEIIPNDQGNRTTPSYVAFTDTERLVGDAAKNQVAMNPHNTVFDAKRLIGRRFTDPSVQSDMKLWPFKVLSGPGEKPMIEVSYKGEKKQFSAEEISSMILNKMKETAENFLGFKVKNSVVTVPAYFNDSQRQATKDAGAISGMNILRIINEPTAAAIAYGLDKKSSRIGEQHVLVFDLGGGTFDVSVLTIDEGIFEVKATAGDTHLGGEDFDNRLVNHFVSEFRRKHKKDLSGNARALRRLRTSCERAKRTLSSTTQTTIEVDSLFEGIDFYATITRARFEELCMDLFMKCMEPVEKCLRDAKIDKSKIHEVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILTGEGDEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQINVTFDIDANGILNVTAEDKTAGVKNKITITNDKGRLSKDEIDKMVRDAERYKAEDEEVKKKVEAKNGLENYAYNMRNTIKDEKIASKLSQEDKEKIEKGVQETIEWLDKNQLAEVDELEDKLKELEGICNPIIARMYQGGGGGGGAGGGVSMDDDQRPGGGTSGGASGTTGTGPKIEEVD
Length659
PositionUnknown
OrganismNicotiana attenuata (Coyote tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.454
Instability index32.57
Isoelectric point5.36
Molecular weight72273.01
Publications

Function

Annotated function Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.
ECO:0000256	ARBA:ARBA00003955
GO - Cellular Component
endoplasmic reticulum lumen	GO:0005788	IEA:UniProtKB-SubCell
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP21183
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     134.60|      33|      74|     496|     528|       1
---------------------------------------------------------------------------
  496-  528 (52.62/34.51)	EDK...TAGVKNKITITNDKGRLSK.DEIDKMVRD...AE
  533-  565 (40.74/25.04)	EDE...E..VKKKVEAKNGLENYAY.N.MRNTIKDekiAS
  570-  605 (41.23/25.43)	EDKekiEKGVQETIEWL.DKNQLAEvDELEDKLKE...LE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.39|      10|      21|     619|     628|       3
---------------------------------------------------------------------------
  619-  628 (20.68/ 9.57)	GGGGGGAGGG
  635-  644 (20.71/ 9.60)	QRPGGGTSGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.36|      17|      45|     426|     444|       7
---------------------------------------------------------------------------
  426-  442 (29.66/16.28)	PTKKEQIFSTYSDNQPG
  473-  489 (27.71/14.16)	PRGVPQINVTFDIDANG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.02|      17|      21|      37|      54|       8
---------------------------------------------------------------------------
   37-   54 (26.39/25.59)	NRT..TPSYVAFtDTERLVG
   59-   77 (26.62/19.57)	NQVamNPHNTVF.DAKRLIG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP21183 with Med37 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MYQGGGGGGGAGGGVSMDDDQRPGGGTSGGASGTTGTGPKIEEVD
615
659

Molecular Recognition Features

MoRF SequenceStartStop
1) AGGGVSMDDDQRPGGGTSGGASGTTGTGPKIEEVD
625
659