<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21165
| Description |
Uncharacterized protein |
| Sequence | MAANFWTSTHGTNWLLSRQALADCRKIDRQYVTEQDLIKVNIWFAQIITDLGRNLQVRQVIIATAITYFKRFYTKNSFRNTEPNLVAATCMYLACKIEESPQHIKSIIGDMKSIMQERGEPFAYDNQKVAEMEFYLLEELDFNMIVYHPYRSLMTLAQDLGTKNEDVQWAWYVINDSYRTDMCLLYPPHVVAAAALYLQIALRGGAQYDGDYSLTSSSTANNGNAGVTTRKRGAAASNSNPNSSNNETPKVKDIRSWFAQLNVDLEQITDIVQEIISLYNLWGEEDKQNEKIREILTRLLK |
| Length | 301 |
| Position | Kinase |
| Organism | Rhizophagus clarus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Rhizophagus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.358 |
| Instability index | 40.53 |
| Isoelectric point | 5.68 |
| Molecular weight | 34538.77 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.10| 20| 211| 43| 62| 1
---------------------------------------------------------------------------
43- 62 (36.28/25.70) WFAQIITDLGRNLQVRQVII
257- 276 (35.82/25.29) WFAQLNVDLEQITDIVQEII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.09| 28| 103| 76| 103| 3
---------------------------------------------------------------------------
76- 103 (51.86/36.27) NSFRNT.....EPNLVAATCMYLACKIEESPQH
176- 208 (43.23/29.20) DSYRTDmcllyPPHVVAAAALYLQIALRGGAQY
---------------------------------------------------------------------------
|