<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21159
| Description |
Uncharacterized protein |
| Sequence | MLAEFRTKRENGRIRVEDKYQVIGFISSGTYGRVYKARAKKTIKSADGEEKELIYAIKKFKPDKEGDTHTYTGISQSACREISLCRELRHQNIISLQEVLLEDNSIHMVFEYAEHDFLQIIHHHSQHERKPIPEFTIKSFLWQLLNGVAYLHANWVLHRDLKPANILVTADGVVKIGDLGLARIYERPLQPLFNGDKVVVTIWYRAPELLLGSRHYTKAIDIWAVGCIFAELLTLRPIFKGEEAKMDNKKNVPFQKNQLNKIFDVLGKPTKDQWPTIDQQPEYPNLSSFRPSSNRLRDFYTNSCSCKSDAGYGLLSAMLEYDPVKRITAEDALCHPYFEEEPKPSMDSFEGQLYQYPLRAVKSEDNDMKVPPTANSAVQGQAGTTHGGTRGKHGHSGKDEGRPSKRRSYVIADN |
| Length | 414 |
| Position | Kinase |
| Organism | Rhizophagus clarus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Rhizophagus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.582 |
| Instability index | 39.68 |
| Isoelectric point | 8.65 |
| Molecular weight | 47270.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21159
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 67.30| 17| 17| 187| 203| 2
---------------------------------------------------------------------------
159- 185 (15.12/ 7.37) RDLKPaniLVTAD..GVVkigdlglARIY
187- 203 (30.99/22.60) RPLQP...LFNGD..KVV.......VTIW
205- 223 (21.19/13.19) RAPEL...LLGSRhyTKA.......IDIW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.47| 25| 208| 124| 153| 3
---------------------------------------------------------------------------
124- 153 (38.61/40.06) HSQHERKPIPefTIKSFLWQLLNgvaY.LHA
335- 360 (44.85/29.49) HPYFEEEPKP..SMDSFEGQLYQ...YpLRA
---------------------------------------------------------------------------
|