<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21131
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAASSGAEKEKERPGGSTEAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQTGEENQILELLIHRDGEFQELMKLALHQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPGDLF |
Length | 217 |
Position | Middle |
Organism | Trichechus manatus latirostris (Florida manatee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Sirenia> Trichechidae> Trichechus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.558 |
Instability index | 39.08 |
Isoelectric point | 5.76 |
Molecular weight | 23951.95 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21131
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 115.55| 28| 28| 94| 121| 1
---------------------------------------------------------------------------
64- 91 (37.72/25.47) QILELLI.HRDGEFQELMKlALHQGKIHH
94- 121 (43.16/30.18) QVLEKEVEKRDSDIQQLQK.QLKEAEQIL
124- 149 (34.68/22.85) AVYQAK.EKLKS.IEKARK.GAISSEEII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.29| 12| 24| 25| 36| 2
---------------------------------------------------------------------------
25- 36 (18.56/10.59) STRERLLSALED
51- 62 (19.74/11.64) SRNQKLLQTGEE
---------------------------------------------------------------------------
|