<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21123
| Description |
mediator of RNA polymerase II transcription subunit 30 isoform X1 |
| Sequence | MLRNCFCLLAYTYRKSCFSLYFYCSVLPGKLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGLPRFASEERREIAEVNKSTFNQNKREREEQASALVTWGRYESKSTRQHITTVKTMKAKQRPFHVPISCLMDSNKNKNTGLYFNTVATCIK |
| Length | 191 |
| Position | Head |
| Organism | Trichechus manatus latirostris (Florida manatee) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Sirenia> Trichechidae> Trichechus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.640 |
| Instability index | 49.99 |
| Isoelectric point | 9.26 |
| Molecular weight | 22181.17 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21123
No repeats found
|