<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21114
Description |
mediator of RNA polymerase II transcription subunit 30 isoform X2 |
Sequence | MLRNCFCLLAYTYRKSCFSLYFYCSVLPGKLPNGVTYHTGTYQDRLTKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGLPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINTMLAMRN |
Length | 149 |
Position | Head |
Organism | Trichechus manatus latirostris (Florida manatee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Sirenia> Trichechidae> Trichechus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.549 |
Instability index | 44.61 |
Isoelectric point | 9.04 |
Molecular weight | 17558.18 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP21114
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 48| 68| 1
---------------------------------------------------------------------------
48- 68 (35.66/19.59) KLQDHLRQLSILFRKLR.LVYD
119- 140 (32.91/17.70) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|