<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21106

Description transcription elongation factor A protein 2 isoform X2
SequenceMQRGAAGAGGLNGGSPARGGAASAAAGAGGCGGRGWGPGREAEAGAAGAGGGAPEAMMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPVTLHLLQSTRVGMSVNALRKQSSDEEVVTLAKSLIKSWKKLLDASDAKARERRRGGPLPTSSSKEASEAQDPSRKRPELPRTPSTPRITTFPPVPVTCDAVRNKCREMLTAALQTDHDHVAVGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRLSNLKDAKNPSLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC
Length356
PositionUnknown
OrganismDelphinapterus leucas (Beluga whale)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus.
Aromaticity0.03
Grand average of hydropathy-0.592
Instability index53.20
Isoelectric point9.46
Molecular weight38379.45
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
translation elongation factor activity	GO:0003746	IEA:UniProtKB-KW
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21106
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      81.21|      18|      19|      13|      30|       1
---------------------------------------------------------------------------
    5-   24 (30.46/13.95)	AAGAGGlnGG....SPARGGAASA
   25-   45 (28.34/12.48)	AAGAGG..CGgrgwGPGR.EAEAG
   46-   59 (22.41/ 8.35)	AAGAGG..GA....PEAMMG....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.40|      13|      19|     137|     153|       2
---------------------------------------------------------------------------
  137-  151 (19.12/10.80)	DASDAKARERRRggP
  159-  171 (22.29/ 8.91)	EASEAQDPSRKR..P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.32|      14|      18|     194|     208|       3
---------------------------------------------------------------------------
  194-  208 (20.06/16.97)	AVRNKCrEMLTAALQ
  215-  228 (24.27/15.08)	AVGADC.ERLSAQIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.43|      17|      18|      60|      76|       5
---------------------------------------------------------------------------
   60-   76 (28.41/18.95)	KEEEIA.RIARRLDKM.VT
   78-   96 (19.02/10.57)	KSAEGAmDLLRELKAMpVT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21106 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MQRGAAGAGGLNGGSPARGGAASAAAGAGGCGGRGWGPGREAEAGAAGAGGGAPEAMMGKEEEIARIARRLDKMV
2) SDAKARERRRGGPLPTSSSKEASEAQDPSRKRPELPRTPSTPRITTFPP
1
139
75
187










Molecular Recognition Features






MoRF SequenceStartStop




NANANA