<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21102
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKVINARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGAGKPPPPPPPPPGGGPGPAPPPTAASAPSGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKQKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Delphinapterus leucas (Beluga whale) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Monodontidae> Delphinapterus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.979 |
| Instability index | 61.24 |
| Isoelectric point | 9.86 |
| Molecular weight | 27975.61 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP21102
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.30| 25| 39| 186| 211| 1
---------------------------------------------------------------------------
187- 211 (44.88/24.31) PPKKKNKQKHKQSRTQDPVPPETPS
227- 251 (43.42/19.07) ERKRKKKEKKKKKNRHSPDHPGVGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.49| 16| 21| 42| 57| 2
---------------------------------------------------------------------------
42- 57 (36.04/11.74) AGKPPPPPPPPPGGGP
66- 81 (29.45/ 8.26) ASAPSGADKSAAGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 14| 38| 84| 97| 5
---------------------------------------------------------------------------
84- 97 (25.31/12.20) LMRELPGSTELTGS
125- 138 (27.69/13.89) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|