| Description | mediator of RNA polymerase II transcription subunit 29 isoform X3 |
| Sequence | MAASQQQASAASSAASVSGPGSAGGSGPQQQPQPPTQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLVQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLPPSPTPSSLTACPIRNTWRSSKPRLPVPRTFTLPCWTAPTRSQARRLRRLRARGALCELAGLGAGLAVVEGMKSGPKQLSL |
| Length | 201 |
| Position | Tail |
| Organism | Delphinapterus leucas (Beluga whale) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.428 |
| Instability index | 71.90 |
| Isoelectric point | 9.64 |
| Molecular weight | 21549.41 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP21093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.50| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (38.59/17.22) GPGSAGGSGPQQQPQPPTQ
40- 58 (35.92/15.58) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MAASQQQASAASSAA 2) RRLRR | 1 165 | 15 169 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab