<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21093
| Description |
mediator of RNA polymerase II transcription subunit 29 isoform X3 |
| Sequence | MAASQQQASAASSAASVSGPGSAGGSGPQQQPQPPTQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLVQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLPPSPTPSSLTACPIRNTWRSSKPRLPVPRTFTLPCWTAPTRSQARRLRRLRARGALCELAGLGAGLAVVEGMKSGPKQLSL |
| Length | 201 |
| Position | Tail |
| Organism | Delphinapterus leucas (Beluga whale) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.428 |
| Instability index | 71.90 |
| Isoelectric point | 9.64 |
| Molecular weight | 21549.41 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.50| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (38.59/17.22) GPGSAGGSGPQQQPQPPTQ
40- 58 (35.92/15.58) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|