<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21077
| Description |
mediator of RNA polymerase II transcription subunit 27 isoform X5 |
| Sequence | MADVLSVGVNLEAFAQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQLDVCLIRLAI |
| Length | 170 |
| Position | Tail |
| Organism | Delphinapterus leucas (Beluga whale) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Monodontidae> Delphinapterus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.289 |
| Instability index | 47.59 |
| Isoelectric point | 9.39 |
| Molecular weight | 18837.40 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP21077
No repeats found
|