<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21066
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAASSSGEKEKERPGGGSGAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQSGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQLLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDIAMNMLPPNHSNDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
Length | 270 |
Position | Middle |
Organism | Delphinapterus leucas (Beluga whale) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Monodontidae> Delphinapterus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.670 |
Instability index | 49.01 |
Isoelectric point | 5.02 |
Molecular weight | 29669.88 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP21066
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.21| 22| 23| 94| 115| 1
---------------------------------------------------------------------------
64- 85 (28.70/17.03) QVLELLI.HRDGEFQELMKlALN
94- 115 (33.71/21.10) QLLEKEVEKRDSDIQQLQK.QLK
119- 140 (29.79/17.91) QILATAVYQAKEKLKSIEK.ARK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.21| 12| 23| 25| 36| 2
---------------------------------------------------------------------------
25- 36 (18.57/10.10) STRERLLSALED
51- 62 (19.64/11.01) SRNQKLLQSGEE
---------------------------------------------------------------------------
|