Description | mediator of RNA polymerase II transcription subunit 22 |
Sequence | MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVSHQVEGTARAPGTLWSPLGFPGWGANHFSGDSAREEGCPRQPRKGLAGSRPRPSCRVLGGGWKEVTPSSLKVLYKCGKQMAR |
Length | 151 |
Position | Head |
Organism | Delphinapterus leucas (Beluga whale) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.779 |
Instability index | 59.50 |
Isoelectric point | 9.54 |
Molecular weight | 16740.77 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP21065 No repeats found |
MoRF Sequence | Start | Stop |
1) LKVLYK 2) YNKRLK | 139 18 | 144 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab