<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21051

Description mediator of RNA polymerase II transcription subunit 26 isoform X2
SequenceMVAVQEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPVHQNEAALRGLAGAPGSANGGAHNCRPEAGAGGPPKSIHDLKNRNDIQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPRVSKVSHDSLVANSSPLPTNGISGSPESFPGPLNSSGHVGPEGSRLEHSENDKHSGKIPVNAVRPHTSSPGLGKPPRPCLQTKAVVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQRSPYTYKGSMPSPSPRPQSLDATQVPSPLPLAQPSTPPVRRLELLPSAESPVRWLEQPEGHQRLAGSGCKAGLPPAEPLLPRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHTEQPRTELDKPEAKASLQSPFEQTNWKELSRNEIIQSYLSQQSSLLSSSGAQTPGAHHFMSEYLKQEESTRRGARKPHVLVPHSPPTDLPGLSREVTQDDLDRIQARQWPGVNGCHDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Length572
PositionUnknown
OrganismDelphinapterus leucas (Beluga whale)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus.
Aromaticity0.04
Grand average of hydropathy-0.915
Instability index60.61
Isoelectric point9.53
Molecular weight62649.61
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP21051
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     132.85|      32|      33|     471|     502|       1
---------------------------------------------------------------------------
  205-  229 (31.80/10.92)	SPGLGKPPRPCLQTKAVVLQQLDRV........
  471-  502 (56.40/24.74)	SSGAQTPGAHHFMSEYLKQEESTRRGARK.PHV
  507-  535 (44.66/18.14)	SPPTDLPG....LSREVTQDDLDRIQARQwPGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     142.90|      34|      34|     242|     275|       2
---------------------------------------------------------------------------
  123-  154 (29.59/ 6.81)	.RGdqrDLGHPGP..........................................P.....PRVSKvsHD.SLV.............ANSSPLP
  190-  265 (36.41/ 9.90)	HSG...KIPVNAVrphtsspglgkpprpclqtkavvlqqldrvdetpgpphpkgpPRCSFSPRNSR..HEGSFA.............RQRSPYT
  266-  299 (42.82/12.80)	YKG...SMPSPSP.........................................rPQ.SLDATQVP..SPLPLA.............QPSTPPV
  329-  376 (34.08/ 8.84)	CKA...GLPPAEP........................................llPRAGFSPDSSK..ADSDAAssggsdskkkkryRPRD.YT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.82|      37|     393|      15|      56|       6
---------------------------------------------------------------------------
   15-   56 (51.66/40.68)	PITKEalEETRLGKLINDVRKKTkneELAK.RAKKLLRS......WQKL
  409-  452 (54.16/30.09)	PLTQK..EPVRADSPVHTEQPRT...ELDKpEAKASLQSpfeqtnWKEL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP21051 with Med26 domain of Kingdom Metazoa

Unable to open file!