<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21049

Description F-box-like/WD repeat-containing protein TBL1X isoform X1
SequenceMTGSIRIQVGIYRVLGALWQQQAHRALYGRSLLPAPTRLRAPGSLALAQDARSGPACSAAPRLPGSCVPVPDAHLSRWELTSVPGLCPQDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASVAATAAAAAPAAPAAPAAVSQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDTCVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKHLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length544
PositionTail
OrganismDelphinapterus leucas (Beluga whale)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus.
Aromaticity0.06
Grand average of hydropathy-0.291
Instability index40.06
Isoelectric point6.25
Molecular weight58441.94
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21049
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     365.94|      40|      40|     352|     391|       1
---------------------------------------------------------------------------
  195-  228 (40.21/17.80)	..LRGHESE...........VFICAWNPVS.........dlLASGS.GDSTARIWNL.......
  254-  289 (39.76/17.53)	.S....NKD...........VTSLDWNSDG.........tlLATGS.YDGFARI.WT.EDGNLA
  290-  320 (38.36/16.68)	STLGQHKGP...........IFALKWNKKG..........nY...........ILSA.GVDKTT
  321-  372 (51.76/24.80)	IIWDAHTGEakqqfpfhsapALDVDWQNNT..........tFASCS.TDMCIHVCRL.GCDRPV
  373-  414 (61.85/30.91)	KTFQGHTNE...........VNAIKWDPSG.........mlLASCS.DDMTLKIWSM.KQDTCV
  415-  463 (45.59/21.06)	HDLQAHSKE...........IYTIKWSPTGpatsnpnsnimLASAS.FDSTV...RLwDVERGV
  466-  507 (60.99/30.39)	HTLTKHQEP...........VYSVAFSPDG.........khLASGS.FDKCVHIWNT.QSGSLV
  508-  539 (27.43/10.06)	HSYRG.TGG...........IFEVCWNARG........dkvGASASdGSVCV............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      97.42|      20|      21|      42|      61|       2
---------------------------------------------------------------------------
   16-   36 (24.92/13.73)	.GALWQQQAHRAlyGRSLLPAP
   42-   61 (35.23/23.04)	PGSLALAQDARS..GPACSAAP
  124-  140 (20.13/ 9.41)	...LAQQQASVA..ATAAAAAP
  146-  160 (17.14/ 6.70)	PAAVSQQNPPKN..GEA.....
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21049 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VAATAAAAAPAAPAAPAAVSQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPNKA
131
192










Molecular Recognition Features






MoRF SequenceStartStop




NANANA