<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21045

Description mediator of RNA polymerase II transcription subunit 26 isoform X1
SequenceMTAAPPSPQQIRDRLLQAIDPQSNIRNMVAVQEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPVHQNEAALRGLAGAPGSANGGAHNCRPEAGAGGPPKSIHDLKNRNDIQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPRVSKVSHDSLVANSSPLPTNGISGSPESFPGPLNSSGHVGPEGSRLEHSENDKHSGKIPVNAVRPHTSSPGLGKPPRPCLQTKAVVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQRSPYTYKGSMPSPSPRPQSLDATQVPSPLPLAQPSTPPVRRLELLPSAESPVRWLEQPEGHQRLAGSGCKAGLPPAEPLLPRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHTEQPRTELDKPEAKASLQSPFEQTNWKELSRNEIIQSYLSQQSSLLSSSGAQTPGAHHFMSEYLKQEESTRRGARKPHVLVPHSPPTDLPGLSREVTQDDLDRIQARQWPGVNGCHDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Length599
PositionUnknown
OrganismDelphinapterus leucas (Beluga whale)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus.
Aromaticity0.04
Grand average of hydropathy-0.910
Instability index63.04
Isoelectric point9.58
Molecular weight65663.00
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21045
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     132.85|      32|      33|     498|     529|       1
---------------------------------------------------------------------------
  232-  256 (31.80/12.20)	SPGLGKPPRPCLQTKAVVLQQLDRV........
  498-  529 (56.40/27.55)	SSGAQTPGAHHFMSEYLKQEESTRRGARK.PHV
  534-  562 (44.66/20.22)	SPPTDLPG....LSREVTQDDLDRIQARQwPGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     216.40|      34|      34|     269|     302|       2
---------------------------------------------------------------------------
  162-  189 (28.65/ 8.20)	P............PR.VSKvsHD.SLV.............ANSSPLP..TNGI.SGS.P..
  269-  302 (65.24/28.00)	P.......RCSFSPR.NSR..HEGSFA.............RQRSPYT..YKGS.MPS.PSP
  304-  338 (33.71/10.94)	P.......Q.SLDAT.QVP..SPLPLA.............QPSTPPV..RRLElLPSaESP
  339-  365 (32.27/10.16)	V.......RWLEQPEgHQR..LAGS.....................G..CKAG.LPP.AEP
  368-  415 (29.54/ 8.68)	P.......RAGFSPD.SSK..ADSDAAssggsdskkkkryRPRD.YTvnLDGQ.VAE.AGV
  416-  448 (26.99/ 7.30)	KpvrlkerKLTFDP...........MT.............RQIKPLT..QKEP.VRA.DSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.89|      17|      18|     120|     136|       4
---------------------------------------------------------------------------
  120-  136 (30.75/19.52)	PPKSIHDL...KNRNDIQRL
  137-  156 (25.14/14.54)	PGQRLDRLgsrKRRGDQRDL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21045 with Med26 domain of Kingdom Metazoa
Unable to open file!