<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21040
Description |
mediator of RNA polymerase II transcription subunit 30 |
Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEDDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 178 |
Position | Head |
Organism | Delphinapterus leucas (Beluga whale) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti>
Monodontidae> Delphinapterus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.590 |
Instability index | 43.40 |
Isoelectric point | 8.45 |
Molecular weight | 20270.03 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP21040
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 77| 97| 1
---------------------------------------------------------------------------
77- 97 (35.66/18.05) KLQDHLRQLSILFRKLR.LVYD
148- 169 (32.91/16.30) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|