<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21039

Description F-box-like/WD repeat-containing protein TBL1X isoform X2
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASVAATAAAAAPAAPAAPAAVSQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDTCVHDLQAHSKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKHLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length523
PositionTail
OrganismDelphinapterus leucas (Beluga whale)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus.
Aromaticity0.07
Grand average of hydropathy-0.285
Instability index39.84
Isoelectric point5.46
Molecular weight56509.40
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21039
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     375.13|      40|      40|     331|     370|       1
---------------------------------------------------------------------------
  174-  203 (34.38/12.37)	..............LRGHESE...........VFICAWNPVS.........dlLASGS.GDSTAR
  222-  259 (43.11/16.97)	HCirEGGHDVP..S....NKD...........VTSLDWNSDG.........tlLATGS.YDGFAR
  260-  289 (30.65/10.40)	I...WTEDGNLASTLGQHKGP...........IFALKWNKKG..........nY...........
  290-  341 (44.81/17.87)	IL..SAGVDKTTIIWDAHTGEakqqfpfhsapALDVDWQNNT..........tFASCS.TDMCIH
  342-  383 (63.00/27.46)	VC..RLGCDRPVKTFQGHTNE...........VNAIKWDPSG.........mlLASCS.DDMTLK
  384-  434 (58.89/25.29)	IW..SMKQDTCVHDLQAHSKE...........IYTIKWSPTGpatsnpnsnimLASAS.FDSTVR
  438-  476 (54.22/22.83)	VE..RGVC...IHTLTKHQEP...........VYSVAFSPDG.........khLASGS.FDKCVH
  477-  518 (46.06/18.53)	IW..NTQSGSLVHSYRG.TGG...........IFEVCWNARG........dkvGASASdGSVCV.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21039 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) APAAPAAVSQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPNKA
121
171










Molecular Recognition Features






MoRF SequenceStartStop




NANANA