<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21027

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMNALQSLTGGPAAGAAGIGLPARGPGQPLGGMGGLGAMGQPMPLSGQPPPGTSGMAPHGMAVVSTAAPQTQLQLQQVALQQQQQQFQAQQQAALQQQQQQQFQVQQSAMQQQFQAVVQQQQLQQQQQQQHLIKLHHQNQQQMQQQQQQQLQRMAQLQLQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQLHHPQHHQPPPQPQPPVAQNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRAPMVVQQPQVQPQVPQVQPQVPPQTAVPTAQASQIVGPGVQVSQSGLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA
Length661
PositionTail
OrganismDelphinapterus leucas (Beluga whale)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Whippomorpha> Cetacea> Odontoceti> Monodontidae> Delphinapterus.
Aromaticity0.03
Grand average of hydropathy-0.669
Instability index92.85
Isoelectric point9.29
Molecular weight72224.38
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
stem cell population maintenance	GO:0019827	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP21027
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.74|      28|      38|     157|     194|       3
---------------------------------------------------------------------------
  157-  194 (44.25/16.19)	QLQQQQQQQQQQqqalqaqPPIQ.QPPMQQPQPppSQaL
  197-  225 (47.49/ 6.27)	QLQQLHHPQHHQ.......PPPQpQPPVAQNQP..SQ.L
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.77|      16|      19|      14|      31|       5
---------------------------------------------------------------------------
   14-   31 (28.02/17.11)	GAAGIGLPArgPGQPLGG
   36-   51 (34.75/15.60)	GAMGQPMPL..SGQPPPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.87|      16|      47|     473|     488|       7
---------------------------------------------------------------------------
  473-  488 (33.17/12.33)	AVPTPP.PPPVPPTKQQ
  521-  537 (26.70/ 8.45)	AIHGPPiTAPVVCTRKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.10|      19|      22|     230|     251|       8
---------------------------------------------------------------------------
  112-  128 (30.37/ 6.97)	QFQA.VVQQQQLQQQ....QQQ
  230-  251 (31.26/13.12)	QTQPLVSQAPALPGQmlyAQPQ
  272-  289 (30.47/ 7.02)	QVQPQVPPQTAVPT....AQAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.62|      29|      35|     406|     436|       9
---------------------------------------------------------------------------
  406-  436 (40.72/34.24)	LDKLKQLSKYIePLRRMiNKID.KNEDRKKDL
  443-  472 (46.90/29.70)	LDILTDPSKRC.PLKTL.QKCEiALEKLKNDM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP21027 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNALQSLTGGPAAGAAGIGLPARGPGQPLGGMGGLGAMGQPMPLSGQPPPGTSGMAPHGMAVVSTAA
2) QQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQLHHPQHHQPPPQPQPPVAQNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRAPMVVQQPQVQPQVPQVQPQVPPQTAVPTAQASQIVGPGVQVSQSGLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGPPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQ
1
166
67
411










Molecular Recognition Features






MoRF SequenceStartStop




1) PQLKLVRAPMVV
250
261