<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP21000

Description mediator of RNA polymerase II transcription subunit 25 isoform X3
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGYTTESLVQKIGEQGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAAPSGASLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQAAPGVGPPFSQAPAPPLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGSVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASAASGQPQPQGAAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPAPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPTQLPPRAPLPVAKRKRDREGHVFREKWERAYFFVEVKSMPMCLICKKIVSVLKEYNLRRHYESKHSKSFDQYTEQMRDAILSELKKGLKGQ
Length794
PositionUnknown
OrganismEnhydra lutris kenyoni
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae> Enhydra.
Aromaticity0.06
Grand average of hydropathy-0.307
Instability index58.12
Isoelectric point9.31
Molecular weight84323.02
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP21000
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.55|      22|      25|     590|     614|       1
---------------------------------------------------------------------------
  590-  614 (36.21/11.23)	PQGTVGasAASGQPQPqGAAQAP..PG
  616-  639 (43.34/ 9.05)	PQGPPG..AAPGPPPP.GPILRPqnPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     153.59|      38|      53|     249|     301|       5
---------------------------------------------------------------------------
  249-  282 (58.39/14.31)	...........P.....AAPS.GASL..SAAPQQPLPPVPQQYQVPGNLSAA..................Q
  294-  353 (31.71/11.95)	NqkagLGPrfsPinplqAAPGvGPPF..SQAPAPPLPPGP.....PGA....pkpppasqpslvstvapgP
  354-  392 (63.49/11.57)	G....LAP...P.....AQPG.APSMagSVAPGGVSGPSPAQLGAPA.LGGQ..................Q
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.74|      16|      66|     574|     589|       6
---------------------------------------------------------------------------
  574-  589 (30.35/ 9.86)	ARPSQNLLQLRPPQPQ
  640-  655 (33.40/11.67)	ANPQLRSLLLNPPPPQ
  686-  700 (26.99/ 7.87)	.QPQLGPPLLHPPPAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     142.71|      43|      66|      86|     130|       7
---------------------------------------------------------------------------
   86-  130 (70.90/57.83)	APTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFddFKK
  155-  197 (71.81/51.26)	AVESTTYSGYTTESLVQKIGEQGIHFSIVSPRKLPALRLL..FEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.55|      19|      24|     457|     475|       8
---------------------------------------------------------------------------
  457-  475 (35.86/21.21)	LTTLGPLFR...N..SRMVQFHFT
  479-  502 (26.69/14.03)	LESLKGLYRimgNgfAGCVHFPHT
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP21000 with Med25 domain of Kingdom Metazoa

Unable to open file!