<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20990

Description cyclin-dependent kinase 19 isoform X1
SequenceMDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAAPQQAAAPPQAPPPQQNSTQTNGTAGGAGTGTGGAGPGLQHSQDSGLSQVPANKKPRLGPSGANSGGPVLPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSAQYHPSHPGHRY
Length502
PositionKinase
OrganismEnhydra lutris kenyoni
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae> Enhydra.
Aromaticity0.09
Grand average of hydropathy-0.695
Instability index52.87
Isoelectric point8.66
Molecular weight56655.38
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP20990
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.01|      21|      37|     421|     456|       1
---------------------------------------------------------------------------
  397-  418 (36.53/16.53)	PPQQNStQTNGTA..........GGAGTGTGG
  421-  451 (32.48/47.85)	PGLQHS.QDSGLSqvpankkprlGPSGANSGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      41|     151|     165|       2
---------------------------------------------------------------------------
  151-  165 (26.77/18.91)	DLKPANILVMGEGPE
  189-  203 (28.67/20.77)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     132.67|      39|      41|     314|     352|       3
---------------------------------------------------------------------------
  314-  352 (68.14/33.38)	KLLTMD.PTKRITSEQALQDPYFQEDPLPTLDVFAGCQIP
  357-  396 (64.53/31.29)	EFLNEDePEEKGDKNQQQQQNQHQQPTAAPQQAAAPPQAP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP20990 with CDK8 domain of Kingdom Metazoa

Unable to open file!