Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKTTDARHRDRAGVEKTMENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTATAAPPGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKKHIPSPTETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
Length | 270 |
Position | Head |
Organism | Enhydra lutris kenyoni |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae> Enhydra. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.065 |
Instability index | 62.39 |
Isoelectric point | 9.94 |
Molecular weight | 29145.97 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20975 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.09| 16| 17| 217| 232| 2 --------------------------------------------------------------------------- 188- 203 (27.76/12.90) PKKKNKHKHKQSRTQD 219- 234 (26.32/11.88) PSDSDHKKKKKKKEED --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 101.98| 31| 123| 116| 147| 4 --------------------------------------------------------------------------- 116- 147 (51.50/27.87) KKVKEKLSNFLPDLPGMIdLPGSHDNSSLRSL 149- 168 (26.85/ 9.77) EKPPILGGSFNP.ITGTM.LAG.......... 253- 269 (23.64/ 7.88) ...........PDHPG.V...GSSQASSSSSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSP 2) GVEKTMENFSALFGA | 221 13 | 253 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab