<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20975
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKTTDARHRDRAGVEKTMENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTATAAPPGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKKHIPSPTETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
| Length | 270 |
| Position | Head |
| Organism | Enhydra lutris kenyoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae>
Enhydra.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.065 |
| Instability index | 62.39 |
| Isoelectric point | 9.94 |
| Molecular weight | 29145.97 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20975
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.09| 16| 17| 217| 232| 2
---------------------------------------------------------------------------
188- 203 (27.76/12.90) PKKKNKHKHKQSRTQD
219- 234 (26.32/11.88) PSDSDHKKKKKKKEED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.98| 31| 123| 116| 147| 4
---------------------------------------------------------------------------
116- 147 (51.50/27.87) KKVKEKLSNFLPDLPGMIdLPGSHDNSSLRSL
149- 168 (26.85/ 9.77) EKPPILGGSFNP.ITGTM.LAG..........
253- 269 (23.64/ 7.88) ...........PDHPG.V...GSSQASSSSSL
---------------------------------------------------------------------------
|