<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20970
Description |
mediator of RNA polymerase II transcription subunit 28 |
Sequence | MAAPLGGMFSGQPPGHPGDSRGQASLLQAAPGPPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPAEIPQGSLAYLEQASANIPAPMKQT |
Length | 175 |
Position | Head |
Organism | Enhydra lutris kenyoni |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae>
Enhydra.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.555 |
Instability index | 57.71 |
Isoelectric point | 5.58 |
Molecular weight | 19434.73 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20970
No repeats found
|