<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20965
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASSSGEKEKERPGGGSGAAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLPPDEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSNDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 270 |
| Position | Middle |
| Organism | Enhydra lutris kenyoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae>
Enhydra.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.695 |
| Instability index | 48.95 |
| Isoelectric point | 4.96 |
| Molecular weight | 29726.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20965
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.67| 27| 28| 62| 88| 1
---------------------------------------------------------------------------
37- 56 (24.35/13.74) ....LEVL..SR..ELIEMLAISRNQKL
62- 88 (46.71/32.06) ENQVLELLI.HRDGEFQELMKLALNQGK
92- 112 (21.61/11.49) EMQVLEKEVeKRDSDIQQLQK.......
---------------------------------------------------------------------------
|