<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20951
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MGETQHVSALPPSPMQYVKEYTDENTQEGLVPKPPPPIKDTYMMFGNQFQCDDLIIRPSESQGIKWLHPMQFDHKKELRKLNMSILINFLDLLGILIRSPGSTKPEEKPEDIKLLFVHVYHLINEYRPHQARETLRVMLEVPKGQCLETAERFQKHLEQVIEMIQNCLALPDDPPHSEAGMRVKTEPMDADDSNNCTGQNEQQRENSGHGRDQVMEKDAALCVLIDEMNERP |
| Length | 232 |
| Position | Middle |
| Organism | Enhydra lutris kenyoni |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae>
Enhydra.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.706 |
| Instability index | 40.19 |
| Isoelectric point | 5.13 |
| Molecular weight | 26711.19 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20951
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.45| 24| 26| 166| 191| 2
---------------------------------------------------------------------------
166- 191 (38.46/26.47) NCLAlpDDPPHSEAGMRVKTEPMDAD
195- 218 (42.99/23.44) NCTG..QNEQQRENSGHGRDQVMEKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.88| 13| 21| 104| 116| 3
---------------------------------------------------------------------------
104- 116 (21.19/12.52) KPEEKPEDIKLLF
127- 139 (21.69/12.97) RPHQARETLRVML
---------------------------------------------------------------------------
|