<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20950

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMNALQSLTGGPAAGAAGIGMPSRGPGQSLGGMGGLGTMGQPMPLSGQPPPGPSGMAPHGMAVVSTAAPQTQLQLQQVALQQQQQQFQQQQVALQQQQQQQQQQQQQQFQAQQNAMQQQFQAVVQQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQLQRMAQLQLQQQQQQQQQALQAQPPLQQPPMQQPQPPPSQALPQQLQPMHHPQHHQPPPQPQQPPVAPNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRTPMVVQQPQVQPQVQQVQPQVQQQTAVPTAQASQIVGSGVQVSQNSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRFEDDERQTIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSAA
Length666
PositionTail
OrganismEnhydra lutris kenyoni
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Mustelidae> Lutrinae> Enhydra.
Aromaticity0.03
Grand average of hydropathy-0.726
Instability index94.00
Isoelectric point9.29
Molecular weight73138.20
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP20950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.27|      31|      36|     338|     368|       6
---------------------------------------------------------------------------
  237-  271 (30.17/ 6.40)	QPL......VSQAPA.LPGQMLyaqpqlklvrtPMVVQQPQV
  338-  368 (56.02/18.44)	QPSSQPNSNVSSGPAPSPSSFL...........PSPSPQPSQ
  468-  496 (40.08/11.01)	IALEKLKNDM.AVPTPPPPP.V...........PPTKQQYLC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.91|      17|      21|      14|      34|       8
---------------------------------------------------------------------------
   14-   32 (31.43/18.26)	GAAGIGMPSRG...PGQSlgGM
   36-   55 (32.48/ 9.16)	GTMGQPMPLSGqppPGPS..GM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.54|      17|     129|     148|     170|       9
---------------------------------------------------------------------------
  163-  179 (33.41/ 8.40)	LQL................QQQQQ....QQQQALQ.AQ
  255-  292 (13.13/ 7.85)	PQLklvrtpmvvqqpqvqpQVQQVqpqvQQQTAVPtAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.42|      30|     154|     426|     460|      12
---------------------------------------------------------------------------
  426-  460 (47.90/35.99)	RMINKIDknedrKKDLSKMKSL.LDILTDPSKRCPL
  583-  613 (47.52/25.39)	HLICKLD.....DKDLPSVPPLeLSVPADYPAQSPL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP20950 with Med15 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MNALQSLTGGPAAGAAGIGMPSRGPGQSLGGMGGLGTMGQPMPLSGQPPPGPSGMAPHGMAVVSTAA
2) QQQQQQALQAQPPLQQPPMQQPQPPPSQALPQQLQPMHHPQHHQPPPQPQQPPVAPNQPSQLPPQSQTQPLVSQAPALPGQMLYAQPQLKLVRTPMVVQQPQVQPQVQQVQPQVQQQTAVPTAQASQIVGSGVQVSQNSLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQ
1
169
67
416

Molecular Recognition Features

MoRF SequenceStartStop
NANANA