Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKVINARCRGTAGAEGTMENFTALFGAQADPPPPPAALGFGPGKPPPPPPPPPGGGPGTAPPPSAATAPPGTDKSAAGCGPFYLMRELPGNTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 261 |
Position | Head |
Organism | Trichechus manatus latirostris (Florida manatee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Afrotheria> Sirenia> Trichechidae> Trichechus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.975 |
Instability index | 59.86 |
Isoelectric point | 9.87 |
Molecular weight | 28005.77 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20936 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.73| 16| 16| 31| 46| 1 --------------------------------------------------------------------------- 31- 46 (36.35/11.86) PPPPPAALGFGPGKPP 48- 63 (37.39/12.40) PPPPPPGGGPGTAPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.91| 16| 17| 207| 222| 2 --------------------------------------------------------------------------- 187- 200 (25.73/10.98) P..PKKKNKHKHKQSR 207- 222 (27.40/12.11) PETPSDSDHKKKKKKK 226- 241 (26.77/11.68) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.27| 19| 38| 79| 97| 3 --------------------------------------------------------------------------- 79- 97 (38.29/17.48) CGP......FYLMRELPGNTELTGS 114- 138 (31.98/13.67) CGKkvkeklSNFLPDLPGMIDLPGS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) FTALF | 212 21 | 246 25 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab