| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKVINARCRGTAGAEGTMENFTALFGAQADPPPPPAALGFGPGKPPPPPPPPPGGGPGTAPPPSAATAPPGTDKSAAGCGPFYLMRELPGNTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Trichechus manatus latirostris (Florida manatee) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Afrotheria> Sirenia> Trichechidae> Trichechus. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.975 |
| Instability index | 59.86 |
| Isoelectric point | 9.87 |
| Molecular weight | 28005.77 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP20936
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.73| 16| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (36.35/11.86) PPPPPAALGFGPGKPP
48- 63 (37.39/12.40) PPPPPPGGGPGTAPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.91| 16| 17| 207| 222| 2
---------------------------------------------------------------------------
187- 200 (25.73/10.98) P..PKKKNKHKHKQSR
207- 222 (27.40/12.11) PETPSDSDHKKKKKKK
226- 241 (26.77/11.68) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.27| 19| 38| 79| 97| 3
---------------------------------------------------------------------------
79- 97 (38.29/17.48) CGP......FYLMRELPGNTELTGS
114- 138 (31.98/13.67) CGKkvkeklSNFLPDLPGMIDLPGS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) FTALF | 212 21 | 246 25 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab