<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20914
Description |
mediator of RNA polymerase II transcription subunit 28 |
Sequence | MAAPLGGMFSGQPPGPQPPPPGLPGQASLLQAAPGAPRTSNITLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLDDINVQHKKPADLPQGSLAYLEQASANIPAPLKQN |
Length | 178 |
Position | Head |
Organism | Trichechus manatus latirostris (Florida manatee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Afrotheria> Sirenia> Trichechidae> Trichechus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.482 |
Instability index | 62.41 |
Isoelectric point | 5.38 |
Molecular weight | 19633.05 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20914
No repeats found
|