Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSALVGYASSSEASSDHEEEMQQVSVQVQVDVPVSAQPPVGPAAPAPAPTPADAPLEQAAPTPSSAPPVVASEPPQAEKDVKDDQDGEQDDDEDEDDDDDDLTPEPDYSFASPPPPLLDTNGHGHGHAEDVEQEHEHKHEHEPPQDNNHDYEEQGKEPTKLKATTRIHELDIVQQDIAKLLHLAGCTLASLDPEPNPNLDLSNEKHTPIPEDKNERFDHFAQAYFTTLNDIQLSLRTSIRHLALSKPSLQALLDPNYASLLPTQALEPGQSSIAAGGIAHRSRIDPLPLTKSIPKWTTRDAQATSAGGVEEDGSMRLSVAARGLQAEAWRDLARIASAAQDPMKE |
Length | 345 |
Position | Head |
Organism | Microbotryum silenes-dioicae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.784 |
Instability index | 50.84 |
Isoelectric point | 4.43 |
Molecular weight | 37258.12 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20893 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 104.59| 25| 28| 33| 58| 1 --------------------------------------------------------------------------- 5- 23 (23.27/ 7.31) .......VGYASSSEASSDH..EEEMQQ 33- 58 (42.06/24.45) PVSAqPPVGPAAPAPAPTPA..DAPLEQ 63- 89 (39.27/18.38) PSSA.PPVVASEPPQAEKDVkdDQDGEQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 144.46| 34| 71| 160| 193| 2 --------------------------------------------------------------------------- 160- 193 (52.80/30.98) KLKATTRIHELDIVQQDIAKLLHLAGCTLASLDP 198- 229 (45.44/25.73) NLDLSNEKH.TPIPEDKNERFDHFAQAYFTTLN. 232- 262 (46.22/26.29) QLSLRTSIRHLALSKPSLQALLD...PNYASLLP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 66.33| 18| 36| 90| 107| 4 --------------------------------------------------------------------------- 90- 107 (32.41/14.21) DDDEDEDDDDDDLTPEPD 129- 146 (33.92/15.19) EDVEQEHEHKHEHEPPQD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LTPEP 2) MSALVGYAS | 102 1 | 106 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab