<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20885
Description |
BZ3500_MvSof-1268-A1-R1_Chr5-2g08053 protein |
Sequence | MQDLPYDESSHMDRLTQAANSLIKIMYSTLSYLTRKANFKPLDPKFPVTQTIPDLDPPHVFQENTNELVADFIRKAKQLEYLIAVLPSTTAFSDLSDPSGTNAQFDPEFEQLEKEIQQSNKEYLEALQLAETLHAQIQASLKAALETRAIPAPPESVVS |
Length | 159 |
Position | Middle |
Organism | Microbotryum saponariae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.406 |
Instability index | 33.80 |
Isoelectric point | 4.65 |
Molecular weight | 17849.90 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20885
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.11| 13| 39| 46| 58| 1
---------------------------------------------------------------------------
46- 58 (25.72/16.11) FPVTQTIPDLDPP
86- 98 (23.39/14.07) LPSTTAFSDLSDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.60| 22| 41| 61| 84| 2
---------------------------------------------------------------------------
61- 84 (31.17/29.32) FQENTNELVADFIRKAKqlEYLIA
105- 126 (37.43/27.60) FDPEFEQLEKEIQQSNK..EYLEA
---------------------------------------------------------------------------
|