<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20879
Description |
BQ5605_C004g02780 protein |
Sequence | MQDLPYDESSHMDRLTQAANSVDDLIKIMYSTLSYLTRKANFKPLDPKFPVTQTIPDLDPPHVFQENTNELVADFIRKAKQLEYLIAVLPSTTTLSDLSDPSGTNAQFDPEFEQLEKEIQQSNKEYLEALQLAETLHAQIQASLKAALETRAIPAPPESVVS |
Length | 162 |
Position | Middle |
Organism | Microbotryum silenes-dioicae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.425 |
Instability index | 32.43 |
Isoelectric point | 4.52 |
Molecular weight | 18175.22 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP20879
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.77| 13| 39| 49| 61| 1
---------------------------------------------------------------------------
49- 61 (26.27/17.83) FPVTQTIPDLDPP
89- 101 (23.50/15.19) LPSTTTLSDLSDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.60| 22| 41| 64| 87| 2
---------------------------------------------------------------------------
64- 87 (31.17/26.28) FQENTNELVADFIRKAKqlEYLIA
108- 129 (37.43/24.73) FDPEFEQLEKEIQQSNK..EYLEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.73| 11| 19| 10| 20| 3
---------------------------------------------------------------------------
10- 20 (20.06/14.47) SHMDRLTQAAN
31- 41 (18.67/13.08) STLSYLTRKAN
---------------------------------------------------------------------------
|