<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20870
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MTVDALGVSSPDAEHHHSMSGEGTRPTYAIEQTLEQLLQSLLEMGICASDVQDSALSSTPGGVASGYPGGLMGRKVSQTMEQLAKLYSYTGTVQDVMIPLEVVNFVDQGKNPHMYTREFIERVAGENMYTNGMLSAVLDYRDILTSSLGDAFPELVNHIRANPHPAGRSASEEGPQVKQENGTHAMDRVDAQLGSNRETGVKMEP |
| Length | 205 |
| Position | Middle |
| Organism | Microbotryum saponariae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.410 |
| Instability index | 39.38 |
| Isoelectric point | 4.82 |
| Molecular weight | 22154.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20870
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.69| 20| 45| 30| 53| 1
---------------------------------------------------------------------------
30- 53 (28.46/28.79) IEQTLEQLLQSLLEMGicasDVQD
76- 95 (35.22/23.18) VSQTMEQLAKLYSYTG....TVQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.28| 20| 48| 111| 132| 2
---------------------------------------------------------------------------
111- 132 (34.81/25.53) NPHMYTREFIERvaGENM.YTNG
162- 182 (33.47/18.79) NPHPAGRSASEE..GPQVkQENG
---------------------------------------------------------------------------
|