| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MSALVEYASSSAASSDHEEEMQQVSVEVDEPASAQPPVHPAAPADAPLEQAAPAPPSAPPVVASEPPQAEQDSKDDQDEDQDEDEDEDDDDDDDDDDMTPEPDYSFASPPPPPLDTNGHGHAEDVDQEHEPPQDNNHDYEEQGEEPTKLKAATRIHELDIVQQDIAKLLHLAGCTLASLDPEPNPNLAPSNEKPTTIPEDKKERFDHFAQAYFTTLNVRLSFPLQDIQLSLRTSIRHLALSKPSLQALLDPNYASLLPTQALEPGQSSIAAGGIAHRCRIDPLPLTKSIPKWTTRDAHATSAARVEEDGSMRLSVAARALQAEAWRDLARIASAGQDRMKE |
| Length | 341 |
| Position | Head |
| Organism | Microbotryum saponariae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.807 |
| Instability index | 54.81 |
| Isoelectric point | 4.29 |
| Molecular weight | 37116.91 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP20869
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 153.08| 50| 63| 18| 80| 1
---------------------------------------------------------------------------
18- 80 (64.12/38.69) EEEmqqvsvEVDEPASAQPPVHPaAPaDAPLeqAAPaPPsaPPVVAS............EPPQAEQDSKDDQDED
84- 145 (88.96/28.42) DED......EDDDDDDDDDDMTP.EP.DYSF..ASP.PP..PPLDTNghghaedvdqehEPPQDNNHDYEEQGEE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) HEEEMQ 2) MSALVEYASS 3) TPEPDYSFAS 4) VHPAAPADAPLE | 17 1 99 38 | 22 10 108 49 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab