<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20853
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MATIDPEVAIVTVEAQLKDIVQNLYNLIVQAYDHHGSKTQEAMKREIQVLVQNLVQLSRTAPSIQINIPPEVMSYVENSRNPDIFTREFVETVQRMNQMLNGRVDAYRMLQEQLARQVSSAIPELKEDVSSLVEATGGRVTV |
Length | 142 |
Position | Middle |
Organism | Pyrenophora tritici-repentis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Pyrenophora.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.217 |
Instability index | 34.20 |
Isoelectric point | 5.01 |
Molecular weight | 16038.13 |
Publications | PubMed=29685100
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transferase activity GO:0016740 IEA:UniProtKB-KW
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP20853
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.38| 22| 54| 56| 77| 1
---------------------------------------------------------------------------
56- 77 (38.58/25.17) QLSRTAPSIQINIPPEVMSYVE
113- 134 (34.80/22.15) QLARQVSSAIPELKEDVSSLVE
---------------------------------------------------------------------------
|