<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20843
| Description |
Fungal-trans-2 domain containing protein |
| Sequence | MLFLQSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVSARNKAQEQAAQATQQLPPAAALKIDTQTASALPSAAPTPKGGATPGAAPGTPGSKGSVGPAPKKKKDRRKSQGGLTSPTTPSVPQ |
| Length | 125 |
| Position | Head |
| Organism | Pyrenophora tritici-repentis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Pyrenophora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.631 |
| Instability index | 44.83 |
| Isoelectric point | 9.65 |
| Molecular weight | 12716.14 |
| Publications | PubMed=29685100
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20843
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.53| 10| 14| 51| 60| 1
---------------------------------------------------------------------------
51- 60 (18.63/ 8.50) QATQQLPPAA
67- 76 (16.90/ 7.19) QTASALPSAA
---------------------------------------------------------------------------
|