<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20824
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSAATVPPHTPHAAPALAKIPKTSTAPPVPASAPLAAQQQSNQTQQTPAENPAPVPPAAEDTPTQDPTLPPAPDSPRTFAARQRELARDLVLKEQQIEYLISVLPGIGSSEAEQERRIRELEGELRRWEGVRGARMQELKALRGRLEGVLGAMEVGVYGERA |
| Length | 193 |
| Position | Middle |
| Organism | Aspergillus indologenus CBS 114.80 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.492 |
| Instability index | 60.69 |
| Isoelectric point | 5.27 |
| Molecular weight | 20920.33 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20824
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.27| 17| 17| 61| 77| 1
---------------------------------------------------------------------------
55- 72 (24.49/ 8.26) STAPP....vPASAPLAAQQQS
73- 94 (23.78/ 7.85) NQTQQtpaenPAPVPPAAEDTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.74| 15| 16| 150| 165| 2
---------------------------------------------------------------------------
150- 165 (25.41/20.54) RELEGeLR.RWEGVRGA
168- 183 (22.33/12.95) QELKA.LRgRLEGVLGA
---------------------------------------------------------------------------
|