Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAQPQQPPTDPTNPQQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVNYPNLLGISQSTDETDATDNKDTATPRDPDAAAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEENFRRDVIRPDVVEALAGNGLPEQAVEGDKAQGEEQQRDQAEQQDGKGS |
Length | 166 |
Position | Middle |
Organism | Aspergillus violaceofuscus CBS 115571 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.793 |
Instability index | 45.31 |
Isoelectric point | 4.41 |
Molecular weight | 18401.94 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20813 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 152.95| 50| 84| 22| 76| 1 --------------------------------------------------------------------------- 22- 76 (79.61/54.73) LTNP.......RFTLELEFVSSLANPYYLSHLAVNypnllGISQSTDETDAT....DNKDTATPRD 102- 162 (73.34/40.50) LTHPgatlralRLLQEENFRRDVIRPDVVEALAGN.....GLPEQAVEGDKAqgeeQQRDQAEQQD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAFAAYLAYLY 2) KAQGEEQQRDQAEQQDGK | 80 147 | 90 164 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab