Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPGAPGGLIHMTMWPEEEWQNQKVFGKEMKVADMDSALHALQMKAMKMEPGAVPNSEQWEDVLGHEKPSKHAGGGDAGKKAVAPPNGARMQANGTPGPGVSDAERSRPSRGRKRHYDENSFVGYGEGYADDDDDGAFYSASDGMGKKKRKKDHVSKISTPLPDRSGSYGVGMFGIGAR |
Length | 212 |
Position | Head |
Organism | Aspergillus violaceofuscus CBS 115571 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.961 |
Instability index | 34.97 |
Isoelectric point | 9.22 |
Molecular weight | 22904.51 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20805 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.22| 31| 47| 99| 144| 3 --------------------------------------------------------------------------- 99- 133 (45.41/40.23) HEKPSKHAGGGDaGkKAVAPPNGARMQAngTPGPG 149- 179 (58.80/20.96) HYDENSFVGYGE.G.YADDDDDGAFYSA..SDGMG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FVGYGEGYADDDDDGAFYSASDGMGKKKRKKDHVSKISTPLPDRSGSYGVGMFGI 2) LRKSY | 155 12 | 209 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab