<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20802
| Description |
Putative RNA polymerase II transcription mediator complex subunit Srb7 |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNSAATVPPQTPHAAPALAKIPKTSSAPPVPASAPLAAQQQSNQTQQTPAENPAPVQPGAPEDTPTQDPTLPPAPDSPRTFAARQRELARDLVIKEQQIEYLISVLPGIGSSEAEQERRIKELEGELRRWEGVRGERMQELKALRGRLEGVLGAMEVGVYGERA |
| Length | 194 |
| Position | Middle |
| Organism | Aspergillus violaceofuscus CBS 115571 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.542 |
| Instability index | 61.88 |
| Isoelectric point | 5.03 |
| Molecular weight | 21041.42 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20802
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.62| 16| 17| 149| 165| 1
---------------------------------------------------------------------------
149- 165 (26.90/25.85) RIKELEGeLR.RWEGVRG
167- 183 (24.72/17.73) RMQELKA.LRgRLEGVLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.53| 16| 17| 76| 91| 2
---------------------------------------------------------------------------
40- 56 (21.07/ 6.31) QTPHAAPALAKiPKTSS
77- 92 (29.46/11.41) QTPAENPAPVQ.PGAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.67| 14| 42| 58| 71| 3
---------------------------------------------------------------------------
58- 71 (26.88/13.11) PPVPASA.PLAAQQQ
102- 116 (23.79/10.84) PPAPDSPrTFAARQR
---------------------------------------------------------------------------
|