<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20798
| Description |
Uncharacterized protein |
| Sequence | MTSRVDQIALHVRKLAQATGVKAHKDDNGKQPFLDGVTSDLDIEALAKSLLDVSKDLDLYLQTLLDPPDLPIASLKSDIAKLQQEMKEKDELLEKCLELVRKTESTFRQLKNRHMGHIYNM |
| Length | 121 |
| Position | Head |
| Organism | Gracilariopsis chorda |
| Kingdom | Rhodophyta |
| Lineage | Eukaryota> Rhodophyta> Florideophyceae> Rhodymeniophycidae> Gracilariales>
Gracilariaceae> Gracilariopsis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.476 |
| Instability index | 37.40 |
| Isoelectric point | 6.06 |
| Molecular weight | 13726.69 |
| Publications | PubMed=29688518
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP20798
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.61| 12| 14| 31| 43| 1
---------------------------------------------------------------------------
31- 43 (16.71/13.44) QPFLDgVTSDLDI
48- 59 (18.90/ 9.67) KSLLD.VSKDLDL
---------------------------------------------------------------------------
|