<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP20797
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MVGQQQRLPPTAESLQKLRVAEQKVLTFLSQATDAVRALSNTESPQVTTATVHAQQVVSNLYDVQAILRNQIDALSSDMPLEDGTKLRLVEADLALQRTAHVHRSLVHILKLFGEPITGMPTTAPSPPYMPSPVANTPVGLVGGMAPTPPAAGAPITIAVPSPDGTTGTNQLSVQMGLNGGAAEGTAEPPNPDAMEM |
| Length | 197 |
| Position | Head |
| Organism | Gracilariopsis chorda |
| Kingdom | Rhodophyta |
| Lineage | Eukaryota> Rhodophyta> Florideophyceae> Rhodymeniophycidae> Gracilariales>
Gracilariaceae> Gracilariopsis.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.107 |
| Instability index | 58.76 |
| Isoelectric point | 5.07 |
| Molecular weight | 20584.23 |
| Publications | PubMed=29688518
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP20797
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 62.27| 12| 33| 116| 127| 1
---------------------------------------------------------------------------
116- 127 (25.28/11.53) PITGMP.....TT..APSP
133- 149 (18.01/ 6.32) PVANTPvglvgGM..APTP
150- 163 (18.99/ 7.02) PAAGAP.....ITiaVPSP
---------------------------------------------------------------------------
|