Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSQSAKRQRTSYSPASPPYHIAAKPSETKTLIVQPNPPPSPPYPSMNSQSNGGFSSSAIGPPSVMTPPASVVMSQQYSPSGLTAGNPPTTFTPASTAGPSNSMHIDSDGDAMMLDTQDSDAAIRLGGRRRTDHNRQPRNIFAPDGGVAAAKGICGSQLFLGCQSSKPSRPHASQDLFELYKLGPLARSVARTNPVTGEKTNKLRKSYEGQIKKMQIAGKHKAVKMDGKFTGLMSLPEEEYYATVVSDKDVSKVGLNSQGTGLNTSLGDLVNRALGGIGPGGLSHSEMIKHRQYIGTDDTAKPKPNLEPTPHRATPSASGTPNTHTPISRISRPERTGSKRQYTDGSYSGYGEGYADDFADSTGGEDNAQGNFAKRRKMGLEQRSRQVEVGGVRR |
Length | 394 |
Position | Head |
Organism | Periconia macrospinosa |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.777 |
Instability index | 61.65 |
Isoelectric point | 9.66 |
Molecular weight | 41961.31 |
Publications | PubMed=29679020 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP20795 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 101.69| 22| 23| 37| 58| 1 --------------------------------------------------------------------------- 14- 34 (27.93/10.62) .PA..SPPYHIAAKPSETKTLIVQ 37- 58 (42.34/19.79) PPP..SPPYPSMNSQSNGGFSSSA 61- 84 (31.42/12.84) PPSvmTPPASVVMSQQYSPSGLTA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 84.18| 25| 234| 88| 138| 2 --------------------------------------------------------------------------- 91- 119 (39.56/61.48) FTPASTAGPSNSMHidsdGDAMMLDTQDS 141- 165 (44.62/12.70) FAPDGGVAAAKGIC....GSQLFLGCQSS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.07| 19| 234| 120| 138| 3 --------------------------------------------------------------------------- 343- 367 (25.17/13.66) TDGSYSGY..gegyadDFADSTGGEDN 368- 394 (21.89/10.94) AQGNFAKRrkmgleqrSRQVEVGGVRR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NFAKRRKMGLEQR 2) SQSAKRQRTSYSPASPPYHIAAKPSETKTLIVQ | 371 2 | 383 34 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab