| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSQSAKRQRTSYSPASPPYHIAAKPSETKTLIVQPNPPPSPPYPSMNSQSNGGFSSSAIGPPSVMTPPASVVMSQQYSPSGLTAGNPPTTFTPASTAGPSNSMHIDSDGDAMMLDTQDSDAAIRLGGRRRTDHNRQPRNIFAPDGGVAAAKGICGSQLFLGCQSSKPSRPHASQDLFELYKLGPLARSVARTNPVTGEKTNKLRKSYEGQIKKMQIAGKHKAVKMDGKFTGLMSLPEEEYYATVVSDKDVSKVGLNSQGTGLNTSLGDLVNRALGGIGPGGLSHSEMIKHRQYIGTDDTAKPKPNLEPTPHRATPSASGTPNTHTPISRISRPERTGSKRQYTDGSYSGYGEGYADDFADSTGGEDNAQGNFAKRRKMGLEQRSRQVEVGGVRR |
| Length | 394 |
| Position | Head |
| Organism | Periconia macrospinosa |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Massarineae> Periconiaceae> Periconia. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.777 |
| Instability index | 61.65 |
| Isoelectric point | 9.66 |
| Molecular weight | 41961.31 |
| Publications | PubMed=29679020 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP20795
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.69| 22| 23| 37| 58| 1
---------------------------------------------------------------------------
14- 34 (27.93/10.62) .PA..SPPYHIAAKPSETKTLIVQ
37- 58 (42.34/19.79) PPP..SPPYPSMNSQSNGGFSSSA
61- 84 (31.42/12.84) PPSvmTPPASVVMSQQYSPSGLTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.18| 25| 234| 88| 138| 2
---------------------------------------------------------------------------
91- 119 (39.56/61.48) FTPASTAGPSNSMHidsdGDAMMLDTQDS
141- 165 (44.62/12.70) FAPDGGVAAAKGIC....GSQLFLGCQSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.07| 19| 234| 120| 138| 3
---------------------------------------------------------------------------
343- 367 (25.17/13.66) TDGSYSGY..gegyadDFADSTGGEDN
368- 394 (21.89/10.94) AQGNFAKRrkmgleqrSRQVEVGGVRR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) NFAKRRKMGLEQR 2) SQSAKRQRTSYSPASPPYHIAAKPSETKTLIVQ | 371 2 | 383 34 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab